Articles submitted by members and non members across NHRDN Chaptershttp://www.nationalhrd.org/National HRD Network. All Rights Reserved ...http://www.nationalhrd.org/articles.php31st Aug, 2009 ...http://www.nationalhrd.org/articles.php31st Aug, 2009 ...http://www.nationalhrd.org/articles.php31st Aug, 2009 ...http://www.nationalhrd.org/articles.php31st Aug, 2009 ...http://www.nationalhrd.org/articles.php31st Aug, 2009 ...http://www.nationalhrd.org/articles.php31st Aug, 2009 ...http://www.nationalhrd.org/articles.php31st Aug, 2009 ...http://www.nationalhrd.org/articles.php31st Aug, 2009 ...http://www.nationalhrd.org/articles.php31st Aug, 2009 ...http://www.nationalhrd.org/articles.php31st Aug, 2009 ...http://www.nationalhrd.org/articles.php31st Aug, 2009 ...http://www.nationalhrd.org/articles.php31st Aug, 2009 ...http://www.nationalhrd.org/articles.php31st Aug, 2009 ...http://www.nationalhrd.org/articles.php31st Aug, 2009 ...http://www.nationalhrd.org/articles.php31st Aug, 2009 ...http://www.nationalhrd.org/articles.php31st Aug, 2009 ...http://www.nationalhrd.org/articles.php31st Aug, 2009 ...http://www.nationalhrd.org/articles.php31st Aug, 2009 ...http://www.nationalhrd.org/articles.php31st Aug, 2009 ...http://www.nationalhrd.org/articles.php31st Aug, 2009 ...http://www.nationalhrd.org/articles.php31st Aug, 2009 ...http://www.nationalhrd.org/articles.php31st Aug, 2009 ...http://www.nationalhrd.org/articles.php31st Aug, 2009 ...http://www.nationalhrd.org/articles.php31st Aug, 2009 ...http://www.nationalhrd.org/articles.php31st Aug, 2009 ...http://www.nationalhrd.org/articles.php31st Aug, 2009 ...http://www.nationalhrd.org/articles.php31st Aug, 2009 ...http://www.nationalhrd.org/articles.php31st Aug, 2009 ...http://www.nationalhrd.org/articles.php31st Aug, 2009 pWe are using a lot of methodsduring interview to select a candidatenbsp However most of the methods get failed or not giving full fruitful resultsnbsp I request all HR patrons to give a great thought on quotstrongwhich is the best method for selecting a right and effective candidatestrongquotp ...http://www.nationalhrd.org/articles.php7th Sep, 2009 pDear AllppCan anybody explain more about the HR strategy nbsp I am keen to learn more about thisnbsp Pl helpppRegardsppHariharanppnbspp ...http://www.nationalhrd.org/articles.php22nd Sep, 2009 pThe Indian industrial scenario has seen rapid transition in the last decade From a traditional factory based mindset the Indian industry has moved on to become world class large conglomerate Indian industry has moved on beyond the Indian borders and is spreading its footprint across the globe Indian family owned businesses are today an epitome of professionally run multinational organization Indian Family run businesses now employ Expats CEOs and employees to run their profit venturesnbsp Clearly the business mindset ndash the way we were used to conducting business of our ind ...http://www.nationalhrd.org/articles.php24th Sep, 2009 pspan classApple-style-span stylefont-family Arial Helvetica Neue Helvetica sans-serif font-size 13px color rgb85 85 85 line-height 19px Walking the talk is very difficult in terms of organizational leadership examples are many -nbspThere was a boss of mine who used to tell everyone to stay late and then leave promptly at 530 pm There is also the typical supervisor who criticizes everyone for spending time on the Internet but is discovered shopping online during working hours We also may have come across finance teams who advise austerity bu ...http://www.nationalhrd.org/articles.php25th Sep, 2009 p styletext-align justifynbsppp styletext-align justifyDear Allpdiv styletext-justify inter-ideograph margin 0in 0in 0ptIt feels nice to be a part of this collaborative and interactive network of knowledge sharing Even as I have posted some of my comments on a few articles on this portal before I havenrsquot yet had the opportunity of interacting with this group as a whole by posting any article This being the first opportunity let me introduce myself in brief I began my professional career as an Executive Trainee HR in NTPC and assum ...http://www.nationalhrd.org/articles.php30th Sep, 2009 pspan font-family styleWhile I was interacting with one of my friends in a reputed MNC IT company in st1country-region on wstst1place on wstIndiast1placest1country-region about cost cutting across firms on account of recession employment crisis in United States and resultant turbulance in talent management to my query regarding his appraisal surprisingly he has responded ldquooh no baba I donrsquot want appraisalrdquo spanppspan font-family styleCouple of months back across IT ...http://www.nationalhrd.org/articles.php7th Oct, 2009 ...http://www.nationalhrd.org/articles.php10th Oct, 2009 ...http://www.nationalhrd.org/articles.php11th Oct, 2009 pnbsppdiv stylemargin 0in 0in 0pt line-height 12ptspan stylecolor blackStarting with sharing few conceptual basics that need to be kept in mind while planning any system or process ie Quality of output of any process or activity depends on the quality of two things spandivdiv stylemargin 0in 0in 0pt 075in text-indent -025in line-height 12pt text-align justifyspan stylecolor blackmiddotspan stylefont 7pt Times New Romannbspnbspnbspnbspnbspnbspnbsp spanspanspan stylecolo ...http://www.nationalhrd.org/articles.php14th Oct, 2009 pnbsppdiv stylemargin 0in 0in 0pt aligncenterbMENTORINGbdivdiv stylemargin 0in 0in 0ptnbspdivdiv stylemargin 0in 0in 0ptbMentoringb is ldquoa deliberate pairing of a more skilled or experienced person with a lesser skilled or experienced one with the agreed upon goal of having the lesser skilled person grow and develop specific competenciesrdquodivdiv stylemargin 0in 0in 0ptnbspdivdiv stylemargin 0in 0in 0ptWhat are the bgoalsb of the mentoring programmedivdiv style ...http://www.nationalhrd.org/articles.php22nd Oct, 2009 pDear Colleagues I recently read with a lot of sadness about how our schools and educational system do not teach us basic values and ethics reproduced an article around a board member of ISB ppBANGALORE Reuters - The Indian School of Business backed by some of thebr stylefont-size 1em leading global companies has been dealt another black eye with an executivebr stylefont-size 1em board member charged over the largest hedge fund insider-trading schemebr stylefont-size 1em br stylefont-size 1em Billionaire ...http://www.nationalhrd.org/articles.php22nd Oct, 2009 pHippMany a times it happens that good people receive appreciations and recognitions frequently Sometimes the appreciation may take them to believe they are superior to anyone else Then starts the attitude problem Its really difficult manage these resources without hurting them especially when we need them to work and they show offppPlease commentp ...http://www.nationalhrd.org/articles.php28th Oct, 2009 pWhat is the difference between mentoring coaching and counsellingp ...http://www.nationalhrd.org/articles.php29th Oct, 2009 ...http://www.nationalhrd.org/articles.php7th Nov, 2009 ...http://www.nationalhrd.org/articles.php7th Nov, 2009 pmeta contenttexthtml charsetutf-8 http-equivContent-Type meta contentWordDocument nameProgId meta contentMicrosoft Word 12 nameGenerator meta contentMicrosoft Word 12 nameOriginator link hreffileCDOCUME1khushiLOCALS1Tempmsohtmlclip11clip_filelistxml relFile-List link hreffileCDOCUME1khushiLOCALS1Tempmsohtmlclip11clip_themedatathmx relthemeData link hreffileCDOCUME1khushiLOCALS1Tempmsohtmlclip11clip_colorschememapping ...http://www.nationalhrd.org/articles.php10th Nov, 2009 p styletext-align justifynbsppp styletext-align justifyspan stylefont-size 9ptTalent Management remains to be a key challenge for HR Practitioners at all times The three elements of Talent Management Spectrum - Attracting Nurturing and Retaining assume great significance in variable proportions in varying environment While attracting amp retaining become difficult in bullish times optimum utilization is altogether a different challenge in recessionary times Let us analyse them One by onespanpdiv styletext-align justifynb ...http://www.nationalhrd.org/articles.php11th Nov, 2009 pEngaging the new generation has been one of the more if not most challenging areas in modern organizations for people managers How do you communicate with a 23 year old who has every part of his body wired and therefore rendered himself incommunicablebr br He may be into his own brand of ldquomultitaskingrdquo ---how chatting on FacebookOrkut with his latest sensation a Midwestern country girl now based in DC and catching up with his mom over his newly acquired mobile set now adding final touches to his project report to be sent to his overseas bosses in Connecticut and ...http://www.nationalhrd.org/articles.php12th Nov, 2009 pThe other day there was a bit of a brawl at the quarterly faculty meeting of a leading management institute in Kolkata India on the sensitive issue of introduction of faculty evaluation by studentsppTwo senior academicians got into a heated debate quotSome 20000 students are getting into WBUT affiliated institutions every year nowdo you know what kind of students are getting inyou want them to evaluate me Excuse mequot one thundered at anotherppI listened with interest the passionately expressed views of the 60 something professor whose lectures I had attend ...http://www.nationalhrd.org/articles.php12th Nov, 2009 pnbsppdiv stylemargin 0in 0in 10ptspan stylefont-size 10pt line-height 115We use Networking to connote our ability to establish wide ranging relationships with as many people as possible feasible in the same profession or working for the same cause It is a network of relationships that are not necessarily interdependent like the network that is created in the IT industry This is what my understanding of the term networking in the context of NHRDN spandivdiv stylemargin 0in 0in 10ptspan stylefont-size 10pt line-height 115 ...http://www.nationalhrd.org/articles.php13th Nov, 2009 pnbsppdiv stylemargin 0in 0in 0pt 05in text-indent -025inspanumlspan stylefont 7pt Times New Romannbspnbspnbspnbsp spanspanCross Cultural Communicationbr br A global environment implies business models based on supply or value chains models resulting from acquisition mergers and restructuring This scenario naturally necessitates that we appreciate diverse cultures in our workforce and acquire necessary skills to deal in cross-cultural communicationdivdiv stylemargin 0in 0in 0pt 025innbspdivd ...http://www.nationalhrd.org/articles.php14th Nov, 2009 p styletext-align justifyspan stylefont-size 9pt color teal font-family ArialYesterday it was a very thought provoking session on role of HRnbspasnbspBusiness Partner The discussion ranged from HR as a Pro-active Intervention to Business People taking up the role of HR Well For any Business to be there grow and flourish - three important assets required are Capital Technology and People Whilenbspmanaging the former two - Capital and Technology are not difficult any more in thenbspCapitalist New Economy it is the third dimension of People as the most ...http://www.nationalhrd.org/articles.php17th Nov, 2009 p style msonormalstrongfont faceverdana size2span ms trebuchet font-family styleTraining amp Developmentspanfontstrongfont faceverdana size2span ms trebuchet font-family style is considered as one of the critical aspects in HR Management and I would project it as mission critical This should be irrespective of size of the organization opopspanfontpp style msonormalfont faceverdana size2 ...http://www.nationalhrd.org/articles.php26th Nov, 2009 pnbsppdivDevelopment Needs Assessment DNA is a systematic exploration of the way things are and the way they should be These quotthingsquot are usually associated with organizational andor individual performancenbspLooking into the capability part not the intent part of making performance happendivdivWHY design and conduct a Development Needs Assessmentdivdiv stylemargin auto 0in auto 05in text-indent -025in text-align justifybfont size3span stylefont-weight normal font-size 10ptmiddotspan stylefont 7pt ...http://www.nationalhrd.org/articles.php1st Dec, 2009 p classMsoNormal stylemargin 0in 0in 0pt text-align justifyfont faceTimes New Roman size3Dear Friendsfontpp classMsoNormal stylemargin 0in 0in 0pt text-align justifyopfont faceTimes New Roman size3nbspfontoppp classMsoNormal stylemargin 0in 0in 0pt text-align justifyfont faceTimes New Roman size3I am doing a research work on ldquoA Study of Strategic Issues of Recruitment Selection and Training in IT Industryrdquo Period 1998-2007font ...http://www.nationalhrd.org/articles.php8th Dec, 2009 pfont faceTimes New Roman size3p classMsoNormal stylemargin 0in 0in 0pt text-align justifyDear Friendpp classMsoNormal stylemargin 0in 0in 0pt text-align justifyopnbspoppp classMsoNormal stylemargin 0in 0in 0pt text-align justifyI am doing a research work on ldquoA Study of Strategic Issues of Recruitment Selection and Training in IT Industryrdquo Period 1998-2007pp classMsoNormal stylemargin 0in 0in 0pt text-align justifyopnbspoppp cl ...http://www.nationalhrd.org/articles.php8th Dec, 2009 pDear friendsppI conduct soft skills beahvioural and management training workshops The training brochure is uploaded to this post however in case of difficulty in downloading you can download my Training e-brochure from the following linkpphttpwwwdivsharecomdownload8362068-186ppIt would be my pleasure to train the staffs of your companyppRegardspbr span stylefont-weight bold font-style italic font-family arial color rgb0 0 191Dinesh V Divekarspanbr stylefont-weight bold font-family arial span st ...http://www.nationalhrd.org/articles.php13th Dec, 2009 pspan classApple-style-span stylefont-size 19px font-weight bold -webkit-text-decorations-in-effect underline Secrecy and Confidentialityspanpp classMsoNormal styletext-alignjustifytext-justifyinter-ideographspan langEN-US stylefont-size110ptmso-bidi-font-size120ptopnbspopspanpp classMsoNormal styletext-alignjustifytext-justifyinter-ideographspan langEN-US stylefont-size110ptmso-bidi-font-size120ptWith increasing competition the confidentiality p ...http://www.nationalhrd.org/articles.php17th Dec, 2009 ...http://www.nationalhrd.org/articles.php4th Jan, 2010 ...http://www.nationalhrd.org/articles.php1st Feb, 2010 ...http://www.nationalhrd.org/articles.php4th Feb, 2010 ...http://www.nationalhrd.org/articles.php6th Feb, 2010 pnbspbfont faceTrebuchet MS size2span styleFONT-WEIGHT bold FONT-SIZE 10pt FONT-FAMILY Trebuchet MSDear Allspanfontbpp classMsoNormalfont faceTrebuchet MS colornavy size2span styleFONT-SIZE 10pt COLOR navy FONT-FAMILY Trebuchet MSopnbspopspanfontpp classMsoNormal styleBACKGROUND white TEXT-ALIGN center aligncenterbifont faceTrebuchet MS colorff9900 size3span styleFONT-WEIGHT ...http://www.nationalhrd.org/articles.php8th Feb, 2010 pnbspDear Sir Madampp classMsoNormalifont faceTrebuchet MS colornavy size2span styleFONT-SIZE 11pt COLOR navy FONT-STYLE italic FONT-FAMILY Trebuchet MSopnbspopspanfontipp classMsoNormalifont faceTrebuchet MS colornavy size2span styleFONT-SIZE 11pt COLOR navy FONT-STYLE italic FONT-FAMILY Trebuchet MSSubbspan styleFONT-WEIGHT bold uThree Day Seminar on quotFPGAs for Signal Processing and Embedded Applicat ...http://www.nationalhrd.org/articles.php8th Feb, 2010 ...http://www.nationalhrd.org/articles.php18th Feb, 2010 pnbspDear Sir Madampp classMsoNormalifont faceTrebuchet MS colornavy size2span styleFONT-SIZE 11pt COLOR navy FONT-STYLE italic FONT-FAMILY Trebuchet MSopnbspopspanfontipp classMsoNormalifont faceTrebuchet MS colornavy size2span styleFONT-SIZE 11pt COLOR navy FONT-STYLE italic FONT-FAMILY Trebuchet MSSubbspan styleFONT-WEIGHT bold uThree Day Seminar on quotFPGAs for Signal Processing and Embedded Applicat ...http://www.nationalhrd.org/articles.php19th Feb, 2010 pnbspbfont faceTrebuchet MS size2span styleFONT-WEIGHT bold FONT-SIZE 10pt FONT-FAMILY Trebuchet MSDear Membersspanfontbpp classMsoNormalfont faceTrebuchet MS colornavy size2span styleFONT-SIZE 10pt COLOR navy FONT-FAMILY Trebuchet MSopnbspopspanfontpp classMsoNormal styleBACKGROUND white TEXT-ALIGN center aligncenterbifont faceTrebuchet MS colorff9900 size3span styleFONT-WEI ...http://www.nationalhrd.org/articles.php19th Feb, 2010 pnbspTalent Acquisition has always been referred to as a sales driven function in the Human Resource domain and I tend to agree with such a broad conjecture In an economy being driven more on Intellectual capital and an apparent shift from the traditional machinist roles pretty evident acquiring and nurturing talent has become criticalnbsppp stylemargin-top 1em margin-right 0px margin-bottom 1em margin-left 0px padding-top 0px padding-right 0px padding-bottom 0px padding-left 0px border-top-width 0px border-right-width 0px border-bottom-width 0px borde ...http://www.nationalhrd.org/articles.php1st Mar, 2010 pnbspstrongOrganizational Development via Cultural Transformationstrongpp aligncenter styletext-aligncenterstrongi stylemso-bidi-font-stylenormalRethink Redesign Rebuild Beyond Culture Set Limitsistrongi stylemso-bidi-font-stylenormalopopipp alignright styletext-alignrightMRArurlajapp alignright styletext-alignrighta hrefmailtoarulraja1gmailcomarulraja1gmailcomapp alignright styletext-alignrighta hrefhttpww ...http://www.nationalhrd.org/articles.php10th Mar, 2010 pDear HR luminariesppMinimum wage in Haryana is revised wef from 112010 May please find the attachment for the official Notification The revised ratesnbspare as followpptable cellspacing0 cellpadding0 width814 border0 stylewidth 6105pt border-collapse collapse tbody tr styleheight 12pt td valigntop width40 styleborder-right windowtext 1pt solid padding-right 0in border-top windowtext 1pt solid padding-left 0in padding-bottom 0in border-left wi ...http://www.nationalhrd.org/articles.php12th Mar, 2010 pDear Allpphave you wondered whatnbspa scientist in research and development at pharma company is doing at this website well i was impressed by Mr Sudhir Sohoni workshop at pune recently wherein i was sent by my organisation as peoples managernbspi am non HR personppso let me know how do i start with ppwhat should i doppam i a round coin in a square holeppawaiting your feedbackppSnehappnbspp ...http://www.nationalhrd.org/articles.php17th Mar, 2010 pnbsppdiv stylemargin 0in 0in 0pt aligncenterbuspan stylefont-size 16ptIts NOT all about MONEYspanubdivdiv stylemargin 0in 0in 0ptnbspdivdiv stylemargin 0in 0in 0ptIt seems all- this life this career this job this home this family is about money The present Indian generation has tasted success outwardly Outward is obvious the senses pour out naturally itrsquos easy to see others itrsquos more convenient to judge others The vibrant economy the global village has added to their glory the lower needs apparently seem t ...http://www.nationalhrd.org/articles.php22nd Mar, 2010 ...http://www.nationalhrd.org/articles.php23rd Mar, 2010 pnbspspan stylefont-size140ptfont-familyquotArial Narrowquotquotsans-serifquotmso-bidi-font-familyquotArial NarrowquotAre You spanspan stylefont-size160ptfont-familyquotArial Narrowquotquotsans-serifquotmso-bidi-font-familyquotArial NarrowquotREADYspanspan stylefont-size140ptfont-familyquotArial Narrowquotquotsans-serifquotmso-bidi-font-familyquotArial Narrowquot for spanspan stylefont-size200ptfont-familyquotArial Narrowquotquotsans-serifquotmso-bidi-font-family ...http://www.nationalhrd.org/articles.php25th Mar, 2010 pbigp styletext-align justifyspan stylefont-weight boldI like the idea of Right to Education along with the quotRight to Choose the Education Institutionquot While education is a great leveller the mind amp heart can be trained to its final acceptance only by the sharing of the facilities and opportunities in an open and honest competitive endeavour that sublimely accepts the right to economic activity for all For too long we have allowed birth-right distinctions to dominate our thoughts and let it reflect in our actions while the words s ...http://www.nationalhrd.org/articles.php2nd Apr, 2010 p styletext-align center p aligncenter styletext-aligncenterline-height1505ptp aligncenter styletext-aligncenterline-height1505ptfont classApple-style-span color993366 faceMicrosoft Sans Serifbbr bfontppp ...http://www.nationalhrd.org/articles.php3rd Apr, 2010 p styletext-align centerstrongspan stylecolor navyBuilding a Highly Engaged and Productive Workforcespanstrongpdiv styleline-height 1505pt aligncenterstrongispan stylecolor navyPost Recession we need to build Robust and Fail-Proof Organizationsspanistrongdivdiv styleline-height 1505pt aligncenternbspdivdiv styleline-height 1505ptOne of the things that architects keep discussing after massive earthquakes like the one that devastated Haiti is how to build better ...http://www.nationalhrd.org/articles.php7th Apr, 2010 pspan stylefont-size 14pt color 333399Beyond information recall Assessments That Measure Knowledge Skill amp Abilityspanpdiv stylemargin 0in 0in 0ptnbspdivdiv stylemargin 0in 0in 0pt line-height 15pt text-align justifyspan stylefont-size 10pt color 333399A question that always comes up to most of us while creating assessments for our students and corporate learners is How to write test content that goes beyond testing information recall In other words How to create assessments that not only tests the acquisition o ...http://www.nationalhrd.org/articles.php9th Apr, 2010 ...http://www.nationalhrd.org/articles.php11th Apr, 2010 ...http://www.nationalhrd.org/articles.php15th Apr, 2010 ...http://www.nationalhrd.org/articles.php16th Apr, 2010 pMy dear friendsppIn todays business environment talent management which critical to any business and retaining them is diffcult taskppPlease discuss talent managent practices from the follwoing contextppHow to Identify the top talent of your organizationppHow to identify competencies and behaviour patterns of Talent ppWhat are the key competencies making them critical talent from the restppPresently I am referring one the finest book of Talent management Handbook by BergerampBergerppregardsppRC Maddelappnbspp ...http://www.nationalhrd.org/articles.php19th Apr, 2010 ...http://www.nationalhrd.org/articles.php20th Apr, 2010 p styletext-align center span stylefont-size large span stylecolor rgb255 0 0 nbspbspan stylefont-family Verdana Conflict Resolution the Einsteinrsquos Wayspanbspanspanpp classMsoNormal aligncenter styletext-aligncenterispan stylefont-size100ptfont-familyVerdanacolorblackA four point NLP formula to dissolve problems like experts doopopspanipp classMsoNormal styletext-align right font classApple-style-span face ...http://www.nationalhrd.org/articles.php8th May, 2010 pmeta contenttexthtml charsetutf-8 http-equivContent-Type meta contentWordDocument nameProgId meta contentMicrosoft Word 12 nameGenerator meta contentMicrosoft Word 12 nameOriginator link hreffileCDOCUME1TampPCEL1LOCALS1Tempmsohtmlclip11clip_filelistxml relFile-List link hreffileCDOCUME1TampPCEL1LOCALS1Tempmsohtmlclip11clip_themedatathmx relthemeData link hreffileCDOCUME1TampPCEL1LOCALS1Tempmsohtmlclip11clip_c ...http://www.nationalhrd.org/articles.php6th Apr, 2010 p classMsoNormalfont size2 faceVerdanaspan stylefont-size100ptxdxafont-familyVerdanaCan we deduct different ESIC for two employees in the same companyspanfontpp classMsoNormalfont size2 faceVerdanaspan stylefont-size100ptxdxafont-familyVerdanaWe are a manufacturing company with 2 sister concernsspanfontpp classMsoNormalfont size2 faceVerdanaspan stylefont-size100ptxdxafont-familyVerdanaESIC of Employee No 1 is being ...http://www.nationalhrd.org/articles.php26th May, 2010 pIn the era of 21st century the Human Resource Manager is evolving with the change of competitive marketnbsp environment and the Human Resource Management have to realized that they must play a strategic role in the success of an organization otherwise it will be a tough circumstances to retain the talentsp ...http://www.nationalhrd.org/articles.php1st Jun, 2010 p classMsoNormal aligncenter stylemargin 0in 0in 0pt text-align centeruspan stylefont-size 10pt font-family Arialquotstrongspan stylefont-family Arial mso-bidi-font-style italicManaging Human Capital Post Turbulent Timesspanstrongquotopopspanupp classMsoNormal aligncenter stylemargin 0in 0in 0pt text-align centeruspan stylefont-size 10pt font-family Arialopspan styletext-decoration nonenbspspanopspanupp classMsoNorm ...http://www.nationalhrd.org/articles.php10th Jun, 2010 pIt was her last day in the office When Manoj came from Testing department and told Shreeja ndash ldquoSo last day Are you here till eveningrdquo ldquoYeahrdquo Shreeja replied while still being very busy on her last day ldquoThatrsquos good We have kept a farewell party for you in the evening I will let you know the exact time in an hourrdquo Shreeja replied with beaming eyes quotOh Thatrsquos so nice of yourdquo Rajeev was mesmerized and quite impressed watching this In fact he always fell short of words for Shreeja She really embodied HR Rajeev has joi ...http://www.nationalhrd.org/articles.php11th Jun, 2010 p styletext-align centerstrongnbspspan stylefont-family Arial color purpleManaging Human Capital Post Turbulent Timesspanstrongpdiv styletext-align right margin 0in 0in 0pt alignrightstrongispan stylefont-family Arial color black font-size 10ptMRArulrajaspanistrongdivdiv styletext-align right margin 0in 0in 0pt alignrightstrongispan stylefont-family Arial color black font-size 10pt font-weight normala hrefmailtoarulraja1gmailcomfont col ...http://www.nationalhrd.org/articles.php14th Jun, 2010 pnbsppdiv stylemargin 2pt 0inspan stylecolor ff9900strongspan stylefont-size 12ptJob Responsibilitiesspanstrongspandivdiv styletext-indent -025in margin 0in 0in 0pt 05inspan stylefont-size 11ptOslashspan stylefont 7pt Times New Romannbspnbspnbspnbspnbsp spanspanspan stylefont-size 11ptFormulating amp implementing various HR policiesspandivdiv styletext-indent -025in margin 0in 0in 0pt 05inspan stylefont-size 11ptOsl ...http://www.nationalhrd.org/articles.php1st Jul, 2010 pmeta contenttexthtml charsetiso-8859-1 http-equivContent-Type style typetextcss --style1 font-family Arial Helvetica sans-seriffont-size 12pxcolor 666666line-height18pxtext-alignjustify style2 font-family Arial Helvetica sans-seriffont-size 12pxcolor 007dc3line-height24pxstyle3 font-family Arial Helvetica sans-seriffont-size 10pxcolor 999999style4 font-family Arial Helvetica sans-seriffont-size 11pxcolor 007dc3line-height18pxs ...http://www.nationalhrd.org/articles.php5th Jul, 2010 ...http://www.nationalhrd.org/articles.php6th Jul, 2010 ...http://www.nationalhrd.org/articles.php6th Jul, 2010 ...http://www.nationalhrd.org/articles.php6th Jul, 2010 pnbspDear Friends ppPl tell me how do you find my this artice on leadreship in Hrppregdsppanil kaushikp ...http://www.nationalhrd.org/articles.php18th Jul, 2010 pnbspDear friendsppmy article on training nbspeffectivenessppregdsppanil kaushikp ...http://www.nationalhrd.org/articles.php18th Jul, 2010 p classCM1 aligncenter stylemargin-bottom70pttext-aligncenterfont classApple-style-span color221E1F faceTrebuchet MS size4span classApple-style-span stylefont-size 15pxbfont classApple-style-span faceArial Verdana sans-serif size3span classApple-style-span stylefont-size 12pxp classCM1 aligncenter stylemargin-bottom70pttext-aligncenterbspan stylecolor221E1FWHAT IS LEADERSHIP IN HRbr style ...http://www.nationalhrd.org/articles.php18th Jul, 2010 p styletext-align center nbspbspan stylefont-size150ptcolor221E1FWHY TRAINING DOES NOT LEAVE DESIRED IMPACTspanbpp classCM6 styletext-alignjustifybspan stylefont-size150ptcolor221E1F br stylemso-special-characterline-break spanbspan stylefont-size150ptcolor221E1Fopopspanpp classCM6 alignright stylemargin-bottom0ptmargin-bottom0001pttext-alignrightbspan stylefont-size110ptfont-familyquotTrebuchet MSquot ...http://www.nationalhrd.org/articles.php18th Jul, 2010 pnbsppdivdiv styletext-align center margin 0in 0in 10pt aligncenterbuldquoTwo Blackboard Therapyrdquoubdivdiv styletext-align justify margin 0in 0in 10ptThe preamble of service industry starts with the thumb rule of ldquobiCustomer is the Kingibrdquo There is a paradigm shift in the outlook of business to retain and acquire potential markets globally Especially in service industry there is cut throat completion amongst competitors nbspon every minute variable which makes difference in quality deliverables ...http://www.nationalhrd.org/articles.php20th Jul, 2010 ...http://www.nationalhrd.org/articles.php21st Jul, 2010 pHi allppnbspppplease can anyone help me with the contents of video induction of an organizationppnbspppnbspppThanks and regardsppDeeptip ...http://www.nationalhrd.org/articles.php2nd Aug, 2010 pDear FriendsppThis is Sunil Kr Chhipa working with HPCLnbspMittal Energy Limited and we got corporate office at NoidappWe are looking for behavioral trainers in this region so that we can use them for in-house programsppKindly suggest share any info on thisppRegardsppSunil Kr Chhipapp0 96 54 26 42 43ppnbspppnbspppnbspp ...http://www.nationalhrd.org/articles.php11th Aug, 2010 pspan stylefont-size 12pt font-family quotTrebuchet MSquot mso-fareast-font-family Times New Roman mso-bidi-font-family Times New Roman mso-ansi-language EN-US mso-fareast-language EN-US mso-bidi-language AR-SAHR has always been purely functional contributor however with changing face of corporate world HR is increasingly becoming s strategic business partner Organizations are moving towards cost efficient amp effective processes amp HR is no exception it is important for HR professionals to have comprehensive knowledge of changingdynamic ...http://www.nationalhrd.org/articles.php16th Aug, 2010 ...http://www.nationalhrd.org/articles.php3rd Sep, 2010 pDear AllppThis is Sunil working with LnbspNnbspMittal group at Noida and wish to know about faculty consultant who can help us on in house training sessions for our team leaders on quotPMSnbspFeedback ProcessquotppIf you know any suitable profile pls share with me onppa hrefmailtosunilchhipahmelinsunilchhipahmelinanbsp 096 54 26 42 43ppRegardsppSunilppnbspppnbspppnbspp ...http://www.nationalhrd.org/articles.php16th Sep, 2010 pmeta contenttexthtml charsetutf-8 http-equivContent-Typemeta contentWordDocument nameProgIdmeta contentMicrosoft Word 12 nameGeneratormeta contentMicrosoft Word 12 nameOriginatorlink hreffileC5CDOCUME7E15CSDATTA7E15CLOCALS7E15CTemp5Cmsohtmlclip15C015Cclip_filelistxml relFile-List link hreffileC5CDOCUME7E15CSDATTA7E15CLOCALS7E15CTemp5Cmsohtmlclip15C015Cclip_themedatathmx relthemeData link hreffileC5CDOCUME7E1 ...http://www.nationalhrd.org/articles.php18th Sep, 2010 pspan stylefont-size largerI feel happy to share with you details of the workshop on bEmotional Intelligenceb and Leadership at bDelhib on the b23suprdsup and 24supthsup of November 2010b Dr Daniel Goleman the legendary name on Emotional Intelligence is justly credited with ushering it in the business world would help us understand Emotional Intelligence as the key driver for personal competence and organizational and team leadership spanpdivspan stylefont-size largerOutstanding Business leaders like Jack Welch and behavioural Ana ...http://www.nationalhrd.org/articles.php19th Sep, 2010 pnbsppp classMsoNormal stylemargin 0cm 0cm 10ptspan styleline-height 115 color 002060 font-size 22ptfont faceCalibrispan stylemso-spacerun yesnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbsp spanTHE NEW MANopopfontspanpp classMsoNormal stylemargin 0cm 0cm 10ptspan styleline-height 115 color 002060 font-size 14ptfont faceCalibriI still the day when i came to kolkata 6supthsup of jul ...http://www.nationalhrd.org/articles.php28th Oct, 2010 pnbsppdiv stylemargin 0cm 0cm 10ptspan styleline-height 115 font-size 12ptnbspnbspnbspnbspnbspnbspnbsp nbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspspanspan styleline-height 115 color 002060 font-size 22ptNETWORKING MATTERS spandivdiv stylemargin 0cm 0cm 10ptspan styleline-height 115 color 002060 font-size 22ptnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbsp ...http://www.nationalhrd.org/articles.php28th Oct, 2010 pnbspnbspspan classApple-style-span stylecolor rgb255 102 0 nbspspan stylecolor rgb128 0 128 bspan langEN-US stylefont-size 24pt line-height 36px Leading H R Managersspanbspanspanpdiv stylebackground-color rgb255 255 255 padding-top 5px padding-right 5px padding-bottom 5px padding-left 5px margin-top 0px margin-right 0px margin-bottom 0px margin-left 0px font-family Arial Verdana sans-serif font-size 12px div stylebackground-color rgb255 255 255 pad ...http://www.nationalhrd.org/articles.php1st Nov, 2010 pnbspKindly Download PDF file of this ArticleppFile size 14MBnbspp ...http://www.nationalhrd.org/articles.php6th Nov, 2010 pnbsppdiv stylemargin 0in 0in 0pt aligncenterbuspan stylefont-size 24pt color greenConfidence spanubdivdiv stylemargin 0in 0in 0ptnbspdivdiv stylemargin 0in 0in 0ptnbspdivdiv stylemargin 0in 0in 0ptThe business executive was deep in debt and could see no way outdivdiv stylemargin 0in 0in 0ptnbspdivdiv stylemargin 0in 0in 0ptCreditors were closing in on him Suppliers were demanding payment He sat on the park bench head in hands wondering if an ...http://www.nationalhrd.org/articles.php15th Nov, 2010 p styletext-align justifystrongDear Learned Membersstrongpp styletext-align justifyThe campus recruitment activities are open once again and most of the engineering colleges are flocking around IT giants requesting their presence in their esteemed institutionspp styletext-align justifyInbsphave a small but valuable submissions As we have tier A B ampnbspC companies in the market similarly we have tier A B amp C engineering institutions A amp B insititutions may not have problem in attracting good brands but what worries a l ...http://www.nationalhrd.org/articles.php17th Nov, 2010 pspan stylefont-size larger span stylefont-family Arial nbspThe termnbspb styleline-height 122em ldquoORGANISATIONAL CULTURErdquobnbsprefers to the norms and values of an organization which together make the personality of the companyspan styleline-height 122em nbspspanspan styleline-height 122em nbspspanImproving organizational culture is the need of the hour as people want to work for a company that enables them to maintain a balance between their work life and personal life and organizations who ...http://www.nationalhrd.org/articles.php23rd Nov, 2010 ...http://www.nationalhrd.org/articles.php24th Nov, 2010 ...http://www.nationalhrd.org/articles.php24th Nov, 2010 pnbspspan classApple-style-span stylefont-family Arial font-size 19px color rgb0 0 255 Regular Monitoring amp Better ROI ROE of your HR Programsspanpp classMsoNormal aligncenter stylemargin-right-90pttext-aligncenteruspan stylefont-size140ptfont-familyArialcolorbluendash An Innovative amp Reliable German Devicespan classapple-style-spanopopspanspanupp classMsoNormal stylemargin-right-90pttext-alignjustifyspan stylefont-size110ptf ...http://www.nationalhrd.org/articles.php25th Nov, 2010 TALENT RETENTIONAmong all attributes and special skills required for managers the ability to manage the diversity in workforce is the most challenging one To heighten sensitivity to appreciating that God has not made us all alike and to appreciate the qualities each one has requires activation of the third eye and the sixth sense As the legendary baseball champion Yogi Berra once said dont always follow the crowd because nobody goes there anymore Its too crowded To make workplace unique enough for the talented to flock in instead of the crowd individuality must be maintained at a ...http://www.nationalhrd.org/articles.php30th Nov, 2010 pnbspppHello I have sought admission for undergoing PhD in HR on TV broadcasting industry I request you to kindly suggest suitable topic for the research Talent specifically creative people working for TV channels are key for producing content Measuring performance of a News Head Animation Graphics person Video Editor Cameraman Light man Sound recordist and script writer is not only cumbersome but poses new challenges for HR managers to quantify the parameters Even qualitative measurement poses challengesppLooking forward for some valid inputs from the ancho ...http://www.nationalhrd.org/articles.php27th Dec, 2010 pDear AllppPls sugegst details of good trainers in the domain of pp Time Managementpp Presentation SkillsppRegardsppSunil Kr Chhipapp0 9654264243ppnbspppnbspppnbspp ...http://www.nationalhrd.org/articles.php31st Dec, 2010 pDear SirMadamppnbspppI have attached an article on Employee Engagement A Case study at IVRCL for publicationppnbspppThanks and RegardsppSuresh Kandulapatipp9177391989p ...http://www.nationalhrd.org/articles.php3rd Jan, 2011 ...http://www.nationalhrd.org/articles.php3rd Jan, 2011 pThe attached presentation describes the One Page Talent Management OPTM approach to building better leaders faster nbspemOne Page Talent Management Eliminating Complexity Adding Valueem Harvard Business Press describes an approach to building talent that relies on easy to use processes accountability for results and transparency about the practices used nbspppFeel free to use this presentation in any way you like just please credit the materialppBest regardsppMarc EffronppAuthor One Page Talent Management httpwwwonepagetmcomppP ...http://www.nationalhrd.org/articles.php24th Jan, 2011 h3 classquestionemstrongspan stylefont-size largerspan stylefont-family ArialWhat is the most important factor for mid-level positionsspanspanstrongemh3ol liemstrongspan stylefont-size largerspan stylefont-family ArialPrevious Employerbr spanspanstrongemli liemstrongspan stylefont-size largerspan stylefont-family ArialRelevant Skillsbr spanspanstrongemli liemstrongspan stylefont-size larger ...http://www.nationalhrd.org/articles.php31st Jan, 2011 p styletext-align justify classMsoNormalfont size2 faceTrebuchet MS colornavyspan stylefont-size 10pt color navy font-family Trebuchet MSHispanfontpp styletext-align justify classMsoNormalfont size2 faceTrebuchet MS colornavyspan stylefont-size 10pt color navy font-family Trebuchet MSWe take this opportunity in introducing Talent Hub Management Consultants an emerging recruitment firm Over a period of functioning Talent Hub Man ...http://www.nationalhrd.org/articles.php1st Feb, 2011 pGreetings of the dayppnbspppWe are urgently looking for Manager HRnbspFuntioning as Plant Head HR for one of our valued pharmaceutical clients based at Ankleshwar having 3 manufacturing units and corporate at MumbaippCandidate should be Masters in HR Personnel Management with around 10 years of relevant experience in HR Brief role includes Recruitment ampnbspSelection Training ampnbspDevelopment Plant administration Salary ampnbspWages administration Legal compliances Welfare activities etcppCompany is a medium scale pharma compan ...http://www.nationalhrd.org/articles.php2nd Feb, 2011 h3 classpost-title entry-titlea hrefhttpsudhakariprabublogspotcom201010innovation-how-to-think-innovativelyhtmlbr aspan stylefont-size largeInnovation - How to think innovativelyspanh3div alignJUSTIFY stylemargin-bottom 0innbspdivdiv alignJUSTIFY stylemargin-bottom 0inIndividuals who can think innovatively are inspirational and influential players who add value to their organization In this article my aim is to explore how to think innovatively rather than explore how organizati ...http://www.nationalhrd.org/articles.php4th Feb, 2011 pThree Types of Learningppspan stylefont-size 12pt font-family quotTimes New RomanquotquotserifquotThis article is based on a research report written by Benjamin Bloomspanpp classMsoNormal stylemargin-bottom 00001pt line-height normalbspan stylefont-size 12pt font-family quotTimes New Romanquotquotserifquot spanbspan stylefont-size 12pt font-family quotTimes New RomanquotquotserifquotThere is more than one type of learning A committee led by Benjamin Bloom identified th ...http://www.nationalhrd.org/articles.php4th Feb, 2011 h3 classpost-title entry-titleAttributes of a mediocre performersh3pI am like many of you constantly exploring ways to help people reach an optimum level of performance peak performance in their professional life Achieving optimum level of performance peak performance helps both the organization and the individual realize their dreams and ambitions I am fully convinced that there are certain attributes that enhance and enable individuals to achieve peak performance while there are certain attributes that prevent people from achieving peak performancebr ...http://www.nationalhrd.org/articles.php4th Feb, 2011 ...http://www.nationalhrd.org/articles.php4th Mar, 2011 pspan stylefont-family Arialpnbsppspanspan stylefont-size mediumspan stylefont-family Arialspan langEN-GBEveryone will be criticised for some reason or other It is perceived for a leader it is easy to give than to receive criticism Since leaders are visible in organizations are more often at the receiving end of criticism than others Therefore it is important for a leader to learn how to handle criticisms and make the best use of it for personal and organizational improvementspan spanspanpp stylemarg ...http://www.nationalhrd.org/articles.php14th Mar, 2011 p--if gte mso 9xmloOfficeDocumentSettingsoRelyOnVML oAllowPNG oOfficeDocumentSettingsxmlendif----if gte mso 9xmlwWordDocumentwViewNormalwViewwZoom0wZoomwTrackMoves wTrackFormatting wPunctuationKerning wValidateAgainstSchemas wSaveIfXMLInvalidfalsewSaveIfXMLInvalidwIgnoreMixedContentfalsewIgnoreMixedContentwAlwaysShowPlaceholderTextfalsewAlwaysShowPlaceholderTextwDoNotPromoteQF wLidThemeOtherEN-USwLidThemeOtherwLidThemeAsianX-NONEwLidThemeAsianwL ...http://www.nationalhrd.org/articles.php21st Mar, 2011 pnbspspan classApple-style-span stylecolor rgb34 34 34 font-family Times New Roman Times FreeSerif serif font-size 15px line-height 21px span stylefont-size small Peak performance is about performing to the fullest potential on a daily basis not one rare spectacular performance and keep talking about it rest of the days Peak-Performers are those who make things happen in organizations and they do it consistently The ability to maintain the same high level of focus intensity and commitment that produce results consistently is wha ...http://www.nationalhrd.org/articles.php7th Apr, 2011 pnbspspan classApple-style-span stylecolor rgb34 34 34 font-family Times New Roman Times FreeSerif serif font-size 15px line-height 21px In organizations there are leaders of all kinds there are ldquoattention seekersrdquo and ldquoattractive peoplerdquo There is a difference between doing something to get attention and becoming a leader of a kind who attract and draw people towards them Even though in both case the end is to influence people to do purposeful things and achieve common goals the way they do it does have an impact on b ...http://www.nationalhrd.org/articles.php7th Apr, 2011 pDonald Kirkpatrick creator of the Kirkpatrick Four Levelstrade Learning Evaluation Model was presented with the 2011 Thought Leadership Award at ISA-The Association of Learning Providersrsquo Annual Business Retreat Awards Dinner held in Scottsdale AZ on March 22 The designation recognizes those whose body of work in support of work-related learning and performance has significantly influenced people and organizationsbr br ldquoDonald Kirkpatrickrsquos work is the gold standard for training evaluation around the worldrdquo says James Chisholm Co-Founder and Prin ...http://www.nationalhrd.org/articles.php27th Apr, 2011 ...http://www.nationalhrd.org/articles.php29th Apr, 2011 ...http://www.nationalhrd.org/articles.php24th May, 2011 ...http://www.nationalhrd.org/articles.php24th May, 2011 ...http://www.nationalhrd.org/articles.php24th May, 2011 ...http://www.nationalhrd.org/articles.php24th May, 2011 ...http://www.nationalhrd.org/articles.php24th May, 2011 p--if gte mso 9xmlwWordDocumentwViewNormalwViewwZoom0wZoomwTrackMoves wTrackFormatting wPunctuationKerning wValidateAgainstSchemas wSaveIfXMLInvalidfalsewSaveIfXMLInvalidwIgnoreMixedContentfalsewIgnoreMixedContentwAlwaysShowPlaceholderTextfalsewAlwaysShowPlaceholderTextwDoNotPromoteQF wLidThemeOtherEN-USwLidThemeOtherwLidThemeAsianX-NONEwLidThemeAsianwLidThemeComplexScriptX-NONEwLidThemeComplexScriptwCompatibilitywBreakWrappedTables wSnapToGridInCell wWrapTex ...http://www.nationalhrd.org/articles.php31st May, 2011 ...http://www.nationalhrd.org/articles.php8th Jun, 2011 p stylebackground transparent border 1px solid ffffff padding 0infont size2 stylefont-size 11ptbHi Group bfontppfont size2 stylefont-size 11ptbMyself New member of NHRD bfontppfont size2 stylefont-size 11ptbCurrently working in Recruitment with 4yrs Experience iam a Graduatebfontppfont size2 stylefont-size 11ptbHere I am serious to know is this Non MBA People are acceptable in HR Generalist area as I am keen to be part of generalist roleb ...http://www.nationalhrd.org/articles.php16th Jun, 2011 pThis article describes Indian firms unique advantage in talent management nbspIncludes quotes from NHRDN President NS Rajan nbspmeta charsetutf-8 span classApple-style-span stylecolor rgb153 153 153 font-family Helvetica Neue Arial sans-serif font-size 11px a titlehttpbitlyjXdtal classhash stylepadding-top 0px padding-right 0px padding-bottom 0px padding-left 0px margin-top 0px margin-right 0px margin-bottom 0px margin-left 0px text-decoration none color rgb153 153 153 outlin ...http://www.nationalhrd.org/articles.php17th Jun, 2011 pHippAny suggestions from someone about knowledge of which laws are sufficient to fit into the competencies of Sr Mgr in HRppnbspp ...http://www.nationalhrd.org/articles.php29th Jun, 2011 ...http://www.nationalhrd.org/articles.php8th Jul, 2011 h6 data-ftquottypequot1 classuiStreamMessagespan stylefont-size x-largespan data-ftquottypequot3 classmessageBodyURGENT REQUIREMENT for HR MANAGER Generalist OPERATION ExecutiveFACILITY MANAGEMENT MANAGER Sales Manager Quality Control Manager SALARY NOT AN ISSUE CENTRE DelhiHaryana MP Gujarat send youryour reference resume at komalsinha15gmailcomspanspanh6 ...http://www.nationalhrd.org/articles.php27th Jul, 2011 p classMsoNormalnbsppp classMsoNormal styletext-align justify Ajay a manager in an ITeS company was confident that he could meet his teamrsquos productivity and quality targets this year Just when he was starting to relax one of his key performers Sudhir decided to quit span stylemso-spacerunyesnbspspanSudhir had seemed a bit aloof lately but nothing Ajay had given a thought to Hiring and training another person would take three months in addition to the costs involved This is not a scenario which is unheard of in the BPO ...http://www.nationalhrd.org/articles.php1st Aug, 2011 p styletext-align justify nbspAjay a manager in an ITeS company was confident that he could meet his teamrsquos productivity and quality targets this year Just when he was starting to relax one of his key performers Sudhir decided to quit span stylemso-spacerunyesnbspspanSudhir had seemed a bit aloof lately but nothing Ajay had given a thought to Hiring and training another person would take three months in addition to the costs involved This is not a scenario which is unheard of in the BPO ITeS world in Indiapp classMsoNormal styl ...http://www.nationalhrd.org/articles.php2nd Aug, 2011 pnbspspan classApple-style-span styleline-height 18px bspan stylefont-size120ptmso-bidi-font-size110ptline-height150font-familyquotTimes New RomanquotquotserifquotPeer Mentoringspanbspanpp classMsoNormal styletext-alignjustifyline-height150ispan stylefont-size120ptmso-bidi-font-size110ptline-height150font-familyquotTimes New RomanquotquotserifquotThe greatest good you can do for another is not just share your riches but to reveal to him his ownspanispan st ...http://www.nationalhrd.org/articles.php10th Aug, 2011 pimg alignleft srcuserfilesbusiness-handshake-accepted1-220x119jpg stylewidth 264px height 209px alt Itrsquos Monday morning 850 am Patricia drives into the parking lot which is half filled parks her car and walks out towards the office somewhat nervous and hesitant since itrsquos her first day at work She is carrying with herself a lot of expectations and high hopes to have a great experience at her new workplace and make a whole lot of friendsppnbspPatricia enters the premises goes to the reception asks for the HR Manag ...http://www.nationalhrd.org/articles.php11th Sep, 2011 ...http://www.nationalhrd.org/articles.php14th Sep, 2011 pnbsppdiv stylemargin 0in 0in 0pt aligncenterbspan stylefont-size 18ptHUMAN BEING MANAGEMENT ndash KEY TO EXCELLENCEspanbdivdiv stylemargin 0in 0in 0pt 05in text-indent -05in alignrightbnbspbdivdiv stylemargin 0in 0in 0pt 05in text-indent -05in alignrightbnbspbdivdiv stylemargin 0in 0in 0pt 05in text-indent -05inbnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbs ...http://www.nationalhrd.org/articles.php14th Sep, 2011 pDear SirppnbspppnbspI have been in the HR fraternity for the last 7 years at Hyderabadnbsp Unfortunately I was not fully aware of the NHRD - chapter servicesnbsp these many yearsnbsp One is aware that the chapter is a non profitable organisation and groom the up coming HRnbspyoungesters and mould them as our HRnbspleadersnbsp Hence it is clear that the organisation helps the freshers and other interested personnel to build their HRnbspcareernbsp ppIt is felt that increasing the Membership Fee from 5100- to 10000- will not only make them to t ...http://www.nationalhrd.org/articles.php1st Oct, 2011 p classMsoNormal styletext-alignjustifyvshapetype id_x0000_t75 coordsize2160021600 ospt75 opreferrelativet pathm45l41191195xe filledf strokedf vstroke joinstylemiter vformulas vf eqnif lineDrawn pixelLineWidth 0 vf eqnsum 0 1 0 vf eqnsum 0 0 1 vf eqnprod 2 1 2 vf eqnprod 3 21600 pixelWidth vf eqnprod 3 21600 pixelHeight vf eqnsum 0 0 1 vf eqnprod 6 1 2 vf eqn ...http://www.nationalhrd.org/articles.php6th Oct, 2011 pspan styledisplay none id1317882630985Snbspspanspan styledisplay none id1317882630047Snbspspanpp classMsoNormalspan stylefont-size medium span stylefont-family Times New Roman span classApple-style-spanNewnbsp opportunities should be givenspanspanspanpp classMsoNormalfont classApple-style-span color993300span stylecolor rgb0 0 0 p classMsoListParagraphCxSpFirst styletext-indent-25inmso-listl ...http://www.nationalhrd.org/articles.php6th Oct, 2011 Bonus PaymentBonus is a reward that is paid to an employee for his good work towards the organization The basic objective to give bonus is to share the profit earned by the organization amongst the employees and staff members In India there is a principle law relating to this procedure of payment of bonus to the employees and that principle law is named as Payment of Bonus Act 1965The Payment of Bonus Act applies to every factory and establishment employing not less than 20 persons on any day during the accounting year The establishments covered under the Act shall continue to pay ...http://www.nationalhrd.org/articles.php10th Oct, 2011 pnbspspan stylefont-size medium span stylefont-family Times New Roman b styletext-align center Recruitment bb styletext-align center span langX-NONETechniques to identify amp weed-out spanbb styletext-align center fake applicantsbspanspanpp classMsoNormalspan langEN-GB stylefont-size120ptline-height115font-familyquotCambriaquotquotserifquotmso-ascii-theme-fontmajor-latinmso-hansi-theme-fontmajor-latinIt is understood across vert ...http://www.nationalhrd.org/articles.php3rd Nov, 2011 pnbspspan styletext-indent -24px font-family Symbol color rgb31 73 125 middotspan stylefont70pt quotTimes New Romanquotnbspnbspnbspnbspnbspnbspnbspnbsp spanspanldquoIndian Professionals coming back to take up challenging and critical new jobsrdquohellip read more span styletext-indent -24px color rgb31 73 125 a hrefhttpbitlyrJrLddhttpbitlyrJrLddaspanpp classMsoListParagraph styletext-indent-25inmso-listl0 level1 lfo1font classApple-style-spa ...http://www.nationalhrd.org/articles.php4th Nov, 2011 pi was the employee of DS CABLE INDIA PVTLTDupto before one yearbut i left the organization due to very genion reasons 1 company was on intial period and production has not started due to legal matters were going on 2 sales of the company was just a trading type so was not getting the perfect knowledge and exposure 3 i was the only employee for india who was handling all the activities for the companyppi got tired and seek after one year and left the organization but since then where ever i appeared for interview i got rejection it is now one and half year i am in serious t ...http://www.nationalhrd.org/articles.php11th Nov, 2011 pView nbspa hrefhttpwwwslidesharenetvinaykumar07employee-engagement-by-vinay-ravindranEmployee Engagement by Vinay Ravindrannbspappnbspp ...http://www.nationalhrd.org/articles.php22nd Nov, 2011 p--if gte mso 9xmloOfficeDocumentSettingsoRelyOnVML oAllowPNG oOfficeDocumentSettingsxmlendif----if gte mso 9xmlwLatentStyles DefLockedStatefalse DefUnhideWhenUsedtrueDefSemiHiddentrue DefQFormatfalse DefPriority99LatentStyleCount267wLsdException Lockedfalse Priority0 SemiHiddenfalseUnhideWhenUsedfalse QFormattrue NameNormal wLsdException Lockedfalse Priority9 SemiHiddenfalseUnhideWhenUsed ...http://www.nationalhrd.org/articles.php29th Nov, 2011 p styleborder-top-width 0px padding-right 0px padding-left 0px border-left-width 0px border-bottom-width 0px padding-bottom 0px margin 0px word-spacing 0px font 13px15px Arial Helvetica Nimbus Sans L sans-serif vertical-align baseline text-transform none color rgb515151 text-indent 0px padding-top 0px white-space normal letter-spacing normal background-color rgb255255255 border-right-width 0px outline-width 0px outline-style initial outline-color initial orphans 2 widows 2 -webkit-text-size-adjust auto -webkit-text-strok ...http://www.nationalhrd.org/articles.php6th Dec, 2011 pmeta contenttexthtml charsetutf-8 http-equivContent-Typemeta contentWordDocument nameProgIdmeta contentMicrosoft Word 12 nameGeneratormeta contentMicrosoft Word 12 nameOriginatorlink hreffileC5CDOCUME7E15CFACULTY5CLOCALS7E15CTemp5Cmsohtmlclip15C015Cclip_filelistxml relFile-List link hreffileC5CDOCUME7E15CFACULTY5CLOCALS7E15CTemp5Cmsohtmlclip15C015Cclip_themedatathmx relthemeData link hreffileC5CDOCUME7E15CFACU ...http://www.nationalhrd.org/articles.php6th Jan, 2012 pmeta contenttexthtml charsetutf-8 http-equivContent-Type meta contentWordDocument nameProgId meta contentMicrosoft Word 12 nameGenerator meta contentMicrosoft Word 12 nameOriginator link hreffileCDOCUME1FACULTYLOCALS1Tempmsohtmlclip11clip_filelistxml relFile-List --if gte mso 9xmloDocumentPropertiesoAuthorRakesh BalachandranoAuthoroVersion1200oVersionoDocumentPropertiesxmlendif--link hreffileCDOCUME1FACUL ...http://www.nationalhrd.org/articles.php6th Jan, 2012 pi need related data ple forward to me for the sake of phdp ...http://www.nationalhrd.org/articles.php24th Jan, 2012 span classhead-boldKey Learnings span br ulliItis time tea estate owners offer performance-linked incentives to thelabourers in the tea gardens to better focus on enhancing workerproductivity liliThe success of an agreement depends on thecommitment and sincerity with which the suggestions laid down in theagreement are implemented liul Tea is one of the fewagricultural commodity products that earns substantial foreign revenuesfor India from the global market Being a labour intensive industrythe Indian tea sector is one of ...http://www.nationalhrd.org/articles.php10th Sep, 2005 span classhead-boldKey Learnings span br ulliImpact of office design on employee productivityliliValidated assumptions about office designliulKnowledge workers rely solely on their mental faculties for theirprofessional success However the contribution of workplace design andother physical attributes also cannot be denied It would thus beappropriate to classify office design as a hygiene factor since itsimpact on workforce productivity is still to be proved Hygiene factorsunlike motivating factors play a dormant role in enha ...http://www.nationalhrd.org/articles.php15th Oct, 2005 span classhead-boldKey Learnings span br ulliAdvantages of performance-based compensationliliTypes of incentivesliliTwo successful stories of performance-based compensation to establish the pointliulEmployers have become a victim of their own deeds When the war fortalent broke out employers were vying against each other for the besttalent Each of them tried offering attractive pay packages andbenefits schemes The strategy did pay handsomely but the returns wererather short lived Today majority of the companies that wer ...http://www.nationalhrd.org/articles.php17th Dec, 2005 span classhead-boldKey Learnings span br ulliIt is extremely critical that organisations effectively manage business continuity in the event of mergers and acquisitions liliAdvanced planning and careful execution of plans determine the rate of success of any merger and acquisition liul span classhead-boldThe key to success spanbr brPeople still talk about the merger success of Hewlett Packard withCompaq two leading computer manufacturers It was one of the mostcomplex me ...http://www.nationalhrd.org/articles.php24th Sep, 2005 span classhead-boldKey Learnings span br ulliThe need for employee orientationliliSustaining a quality workforceliulKens father Ted Blancharda retired captain from the Navy prematurelyHad he continued he would have been an admiral by his own worth Kenasked Dad why did you quit early His father answered Ken I hateto say it but I liked the wartime Navy better than the peacetime NavyNot that I liked to fight but in wartime we knew what our purpose wasand what we were trying to accomplish The problem with the peacetim ...http://www.nationalhrd.org/articles.php29th Oct, 2005 span classhead-boldKey Learnings span br ulliThe need for corporate excellenceliliWho adjudges excellenceliliFactors that contribute to corporate excellenceliul span classhead-boldThe race towards excellencespan br br Recently strongArriveNetcomstrong released a report on the Best Bosses competition 2005 being conducted by strongWinning Workplaces and FSB Fortune Small Business magazinestrong It is good news for Steven E strongSullivan ...http://www.nationalhrd.org/articles.php12th Nov, 2005 span classhead-boldKey LearningsspanulliThe latest changes in the e-learning industry appear to be highly customer friendly lili Tracking and implementing these changes would ensure optimum use of applications and solutions liul Whilesome things never change some change all the time When it comes tothe business world change is the only permanent thing The bestbusiness principle therefore is about doing what is hot andabandoning what is not Tracking trends both big and small helpsorganisations stay abreast of the latest developme ...http://www.nationalhrd.org/articles.php12th Nov, 2005 span classhead-boldKey Learningsspan ulliContrary to popular belief small training programmes and training departments can be as effective as their big brothers lili Elementary proficiency in a broad range of competencies is a must for a one-man training shop liulCan training be a one-man show Can small training departments providelearning that would impact their organisations success Start uporganisations and those with small training budgets have small trainingdepartments where a couple of individuals take charge of all aspects of ...http://www.nationalhrd.org/articles.php21st Sep, 2005 span classhead-boldKey Learningsspan ulliUsing political intelligence to develop effective workplace relationships and improve performance levels lili Political intelligence training educates employees in the positive application of organisational politics liulMany organisations invest heavily in their talent pool by developingtheir EQ and IQ to assist in their rapid rise up the corporate ladderThey however fail to acknowledge the need for PI politicalintelligence which gives them a far greater chance of survival whenthey get th ...http://www.nationalhrd.org/articles.php14th Dec, 2005 span classhead-boldKey Learningsspan ulliAn analytical approach is the best way to improve e-learning usage and effectivenesslili This approach involves understanding the cultural and disciplinary contexts of e-learningliulEver wondered why an Indian never questions his instructor This at atime when an American addressees his instructor by his first name Whydo Saudi Arabians prefer male instructors whereas the Japanese bowtheir heads each time they say certain phrases Trainers atmultinationals are familiar with such scenes but seldo ...http://www.nationalhrd.org/articles.php12th Nov, 2005 span classhead-boldKey Learningsspan ulliA strategic training plan allows organisations to achieve theirtraining objectives with little compromise in the monetary department lili The plan also helps justify budget allocations and training expensesliul p alignjustifyAschallenging as it is to prepare a simple training and developmentbudget the task gets more complicated when a manager has top div alignjustify ulli Prepare a zero- ...http://www.nationalhrd.org/articles.php9th Nov, 2005 span classhead-boldKey Learningsspan ulliThe latest trend in workplace learning is to increase training without increasing training costs liliThe use of cheaper learning tools and a laser focus on meeting specifictraining goals can increase learning without inflating training budgetsliul Idyllic as it sounds learningprofessionals have recognised that they can find suitable replacementsfor multi-day classroom sessions and expensive hard-to-get trainersThe trend in workplace training and development is thus to use new butcheap lea ...http://www.nationalhrd.org/articles.php7th Sep, 2005 span classhead-boldKey Learningsspan ulliTraining experts believe that pretend training makes instructions more effective as knowledge is put to practical use lili The two popular pretend training methods are gaming and computer-based simulationsliulThe more trained the employee the better the performance and lesserthe chances of employees jumping the ship A few years ago one couldeasily find a bunch of protestors who argued that this may notnecessarily be true However today training gets unanimous support br ...http://www.nationalhrd.org/articles.php23rd Nov, 2005 pBy Dominic Rajesh R M HR Professional focusing on Learning amp Development Manager ndash Learning amp Development at a US Healthcare BPO in ChennaippThe HR function which is seen only a people oriented function is the last place that most people think can be transformed through Technology However HR is a function that can multiply its effectiveness and reach through the proper use of technology Technology can enable HR to move from Transactional activities to real transformation of the businessbr br This article would look at the following four key ways by wh ...http://www.nationalhrd.org/articles.php25th Aug, 2009 pstrongA Contextstrongbr br HR Function is being revolutionized through advances in technology and as a result a large proportion transactional activity is getting automated which has created space for transformational aspects of HR function And in the tough times through which all the Companies world over are now battling through world over it is the strategic dimension of HR which is critical for organizational survival in the current times and continued prosperity when good times return Technology has now become a welcome enabler for this processbr br b ...http://www.nationalhrd.org/articles.php26th Aug, 2009 p styletext-align justifystrongAbstractstrongbr br A decade or so ago companies worked with career templates and succession plans that were kept often in locked drawers Not any more For young and dynamic Indian workforce organizations must plan their job offer with L ampD dimensions in mind LampD is intricately linked with the other HR functions in particular recruitment and performance management The function must be run like a business with clear deliverables lsquoprofitrsquo responsibility and most importantly a clear line of sight on how this makes a ...http://www.nationalhrd.org/articles.php11th Sep, 2009 p styletext-align justifybr strongAbstract strongpp styletext-align justifyWith rapidly changing times and the growth of learning organizations this article aims to capture how a consultantrsquos approach in your Learning and Development roadmap can help synergize business goals and claim effective investments in learning It touches upon the various kinds of consulting services and methodologies that have matured in recent times to aid organizations looking for true value in learning partnershipsnbsppp styletext-align justifystrongAbout the author ...http://www.nationalhrd.org/articles.php20th Sep, 2009 p styletext-align justifystrongAbstract strongpp styletext-align justifyThe balance of learning and teaching is an intricate subject that applies to our educationbr system our management styles and how we deal with our employeespp styletext-align justifyThe author has had the pleasure to witness systems of learning in different continents and systems around the world and would like to share some perspectivespp styletext-align justifyThe transition from exclusive education and rare scholars who built and guarded the body of knowledge to a ...http://www.nationalhrd.org/articles.php20th Sep, 2009 p styletext-align justifystrongAbstract strongpp styletext-align justifyLearning and development are very intense complex and serious processes Just as a good teacher is responsible for contributing to the personality of a learner a good developer and facilitator can significantly contribute to building an overall character personality and competence of the organisation In our organisations instead of sub-contracted this process to a particular department or a set of consultants we must make every effort to choose the right people for this role and also invest in the ...http://www.nationalhrd.org/articles.php20th Sep, 2009 p styletext-align justifystrongAbstract strongpp styletext-align justifyMany companies believe that they are Learning Organisations and many more want to become one However the underlying emphasis in the concept of a learning organisation seems to be on organisational learning with individual learning being a primary ingredient and benefit to employees secondary In the context of the present scenario wherein at the slightest hint of a global recession companies have begun massive layoffs an attempt has been made in this paper based on the underlying principles of two ...http://www.nationalhrd.org/articles.php20th Sep, 2009 pnbsppdivnbspdivdivThe article addresses the HR challenges in successfully evolving and implementing new forms of management support systems being tried out in public systems and identifies a number of HR issues including attracting and retaining talent for the temporary programme management unitsnbspdivdivnbspdivdivnbspdivdivVenkatesh Srinivasan Assistant Representative India with United Nations Population Fund has rich consulting evaluating and monitoring experience in international projects He can be reached at srinivasanunfpaorg nbsp ...http://www.nationalhrd.org/articles.php21st Sep, 2009 p classMsoNormal styletext-align justify margin 0cm 0cm 10ptspan styleline-height 115 font-family quotArialquotquotsans-serifquot font-size 10ptOrganization performance has been the focus of scholars since long From Fortune 500 list of companies in 1992 only 120 appear in the list of Fortune 500 for the year 2007 That is over 76 of the Fortune 500 companies disappeared from the list in 15 years Accenture study 2007 In India one of the most readily available organized data on performance of the business organizations is published by Economic Times in te ...http://www.nationalhrd.org/articles.php24th Oct, 2009 pItrsquos a known fact that great companies are made not born and the secret ingredient is its human capital ie the right people for the right job as this ensures we have the best for the pivotal positions within the organization Hence it becomes inevitable to gain a talent advantage for the competitive edge differentiation as we move quickly into a transparent interdependent global reality speed to market is the ultimate competitive weaponppThis can be achieved by consistent high performance of the companyrsquos workforce Performance is always directly proportional to t ...http://www.nationalhrd.org/articles.php28th Oct, 2009 pstrongIntroductionstrongbr How best can you as a training leader ascertain the current relevance and effectiveness of the numerous trainings developed over the years for your organizationppAs organizations mature expand and diversify there is a complementary change in organization goals processes tools applications and roles performed by its workforce To enable their workforce perform optimally in such a dynamic scenario organizations need to periodically perform a comprehensive review of all trainings to assess the relevance and usefulness of the trainings in c ...http://www.nationalhrd.org/articles.php5th Nov, 2009 pstrongPost Recessions we need to build Robust and Fail Proof Organizationsstrongbr br One of the things that architects keep discussing after massive earthquakes like the one we saw in Haiti is how to build better structures so we could withstand future shocks Business world too is just getting out of the disastrous collapse of many of its institutions worldwide Itrsquos good to give a thought on how best to rebuild by engaging the workforce in a very productive way Hope these thoughts will promote actionbr br strongSearching for clues on ldquohi ...http://www.nationalhrd.org/articles.php7th Apr, 2010 p aligncenteremA case study on OD interventions for improving organizationalbr productivity empp aligncenterstrongBy br Ritwik Mishrastrong br ritwikmishratatacommunicationscombr Global ndash Organizational Developmentbr Tata Communications Ltd br VSB Bangla Sahib Roadbr New Delhi 110001ppstrong1 Company Informationstrong br br Smile N Dance is a shopping and night time entertainment complex opened in the late l970rsquos by Mr Dan Smile father of the current president and CEO Dana Smile Dan had envi ...http://www.nationalhrd.org/articles.php13th Apr, 2010 pstrongThe External Force behind Human Resource Developmentstrongppbr There was a time not so long ago when human labour was counted as one among the many lsquofactors of productionrsquo that Managers organized to produce wealth While iron or coal got dug out from mines labour was hunted out of Africa transported across oceans and sold and resold in the emlabour marketsem of the emfreeem worldppbr It did make a lot of business sense then ndash and for many centuries ndash to run business with the lsquofreersquo labour of slavesnbsp ...http://www.nationalhrd.org/articles.php10th Nov, 2010 pCompanies in India as well as in other countries face a formidable challenge of recruiting and retaining talents while at the same time having to manage talent loss through attrition be that due to industry downturns or through voluntary individual turnover Losing talents and employees result in performance losses which can have longterm negative effect on companies especially if the departing talent leaves gaps in its execution capability and human resource functioning which not only includes lost productivity but also possibly loss of work team harmony and social good willp ...http://www.nationalhrd.org/articles.php15th Mar, 2011